PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.012G101000.1
Common NamePOPTR_0012s10290g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 187aa    MW: 21495 Da    PI: 9.0383
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.012G101000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1061.9e-3399157159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vk+s+fprsYYrCt +gC+vkk+v+r+++d+++v++tYeg H+h+
  Potri.012G101000.1  99 LDDGYRWRKYGQKTVKNSKFPRSYYRCTNNGCNVKKQVQRNSKDEEIVVTTYEGMHTHP 157
                         59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-3484157IPR003657WRKY domain
SuperFamilySSF1182901.57E-2991158IPR003657WRKY domain
PROSITE profilePS5081130.74594159IPR003657WRKY domain
SMARTSM007741.7E-3899158IPR003657WRKY domain
PfamPF031061.2E-27100157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MQMEKYQIFL PVSDPSSPSG SPSSLNMANP LIYFHGENEN GVRPESRTQH SDAKHSDPQT  60
SRVSSNSEIK VKPGVRGGDN NEFRKHKYAF QTRSQVDILD DGYRWRKYGQ KTVKNSKFPR  120
SYYRCTNNGC NVKKQVQRNS KDEEIVVTTY EGMHTHPIEK CTDNIEDILR QMQTYTPFEI  180
MPGHFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-2789158776Probable WRKY transcription factor 4
1wj2_A3e-2789158776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2089430.0AC208943.1 Populus trichocarpa clone JGIACSB1089-H10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002318747.11e-140hypothetical protein POPTR_0012s10290g
TrEMBLB9I3U61e-140B9I3U6_POPTR; Uncharacterized protein
STRINGPOPTR_0012s10290.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-51WRKY DNA-binding protein 75